PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_32699-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MIKC_MADS
Protein Properties Length: 230aa    MW: 25865.8 Da    PI: 10.0205
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_32699-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF93.59.5e-30959151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     krien + rqvtfskRrng+lKKA+ELSvLCdaeva+++fs++g+lye++s
  TRIUR3_32699-P1  9 KRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALVVFSPRGRLYEFAS 59
                     79***********************************************86 PP

2K-box67.25.7e-2380170797
            K-box   7 ksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                      ++  + + ++ + ++  L k++e L+ ++R++lGe+L+ +s +eL+ Le ++eksl+ iR kK++ll +qi +l++ke+ l ++n++Lr k
  TRIUR3_32699-P1  80 NKIVQPDIQQVKADALSLAKKLEALEDTKRKILGENLGGCSTEELHFLEGKIEKSLRVIRGKKTQLLEQQIANLKEKERTLLKDNEDLRGK 170
                      4467788999******************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.455161IPR002100Transcription factor, MADS-box
SMARTSM004321.3E-39160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.2E-30383IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
CDDcd002653.29E-40376No hitNo description
PRINTSPR004041.1E-30323IPR002100Transcription factor, MADS-box
PfamPF003198.3E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-303859IPR002100Transcription factor, MADS-box
PfamPF014864.4E-2487170IPR002487Transcription factor, K-box
PROSITE profilePS5129713.09887177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000060Biological Processprotein import into nucleus, translocation
GO:0009409Biological Processresponse to cold
GO:0009739Biological Processresponse to gibberellin
GO:0009911Biological Processpositive regulation of flower development
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MVRGKTQMKR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVALVVFSP RGRLYEFASA  60
TSLQKSIDRY KAYTKDTVNN KIVQPDIQQV KADALSLAKK LEALEDTKRK ILGENLGGCS  120
TEELHFLEGK IEKSLRVIRG KKTQLLEQQI ANLKEKERTL LKDNEDLRGK QRNLEAPLFL  180
PAPNCVAPLQ PRGEPAPEHQ PVPRDDDVET ELYIGLPGVR CSSQRSGQAK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P8e-18174173Myocyte-specific enhancer factor 2B
1tqe_Q8e-18174173Myocyte-specific enhancer factor 2B
1tqe_R8e-18174173Myocyte-specific enhancer factor 2B
1tqe_S8e-18174173Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00076ChIP-chipTransfer from AT2G45660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ5123630.0DQ512363.1 Triticum aestivum MADS-box transcription factor TaAGL7 (AGL7) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983814.11e-111PREDICTED: MADS-box transcription factor 56-like
SwissprotA2Z9Q71e-107MAD56_ORYSI; MADS-box transcription factor 56
TrEMBLM7ZSM11e-168M7ZSM1_TRIUA; MADS-box transcription factor 56
STRINGBRADI3G32090.11e-107(Brachypodium distachyon)
STRINGGRMZM2G070034_P011e-107(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.11e-65AGAMOUS-like 20